DPCstruct | MC32867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A223NYQ0 | 65-136 | APLKSLWYDGKGDWHQAHAQVDHLNDQASAWVHAYLHRKEGDSHNADYWYNKARQTRPQLPLETEWEQLVVQ |
| A0A7Z8PBM6 | 1-69 | MEAIDLTAAGDWDGAHQLVMPERSPAACWLHAILHRMEGDLANADYWYGLAGRRRPSVSTDEELEHLRR |
| A0A3B0UTW7 | 6-79 | None |
| A0A1Q3JYV4 | 1-82 | None |
| A0A2V7XPP9 | 10-89 | None |
| A0A7C4IU60 | 278-357 | None |
| A0A536YI86 | 5-82 | None |
| A0A088EU10 | 10-83 | None |
| A0A0P0ZAE5 | 42-117 | None |
| A0A1Z4L650 | 86-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.