DPCstruct | MC32864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 182 ± 32 aa |
| Standard deviation of domain lengths | 31.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.83 |
| Pfam Score | 78.43 |
| Assigned Pfam label(s) | PF07275- PF19854- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2NPM6 | 9-201 | FPFAAFITNLGKYNEGELVGEWVKFPTTPEKLQEVFERIGIGSADDFGNPYEEWFITDYDCYVDGLYNLLGEYENLDELNYLASKLE… |
| A0A174X2Q3 | 3-192 | LQATIKNGRHPEYGVVSIPFPIPKNEYDHVLELLKSLEIGDAVEQDCCVEKIRSDFFPILKRLETSYVNVDELDYLAKRLESFWDPE… |
| A0A655TCR8 | 21-214 | None |
| A0A830WKS9 | 2-148 | None |
| A0A4R1QP94 | 3-174 | None |
| A0A1X7AMJ4 | 141-317 | None |
| C7N820 | 3-201 | None |
| A0A6I2QWQ8 | 141-304 | None |
| A0A1C6J546 | 2-173 | None |
| A0A7W4QY96 | 17-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.