DPCstruct | MC3286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3SB30 | 5-108 | ETPDDFDRLVISEPNNSSGWLQYMAYYLQTAEIDKSRDVAERALKTISFRESQHLLNIWIAMMNLENLYGTQETLTKVFERAVQRND… |
| A0A2J6LI69 | 1-126 | MKGIHIEERLLQKDIPRTTDDYEKLIRSSPNSSFIWIKNMTFFLSLNEVEKARSMAERALRTINIREESEKMHVWVAYFNLENEYGF… |
| Q4UGH8 | 1-136 | None |
| A0A0P4VYN1 | 596-727 | None |
| A0A7J0F6Q4 | 325-464 | None |
| A0A7G2C645 | 346-473 | None |
| A0A182VQ69 | 588-710 | None |
| A0A0D8Y8U2 | 330-455 | None |
| B8JIP9 | 1523-1651 | None |
| A0A077Z5C6 | 1736-1862 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.