DPCstruct | MC32850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 269 |
|---|---|
| Mean domain length (aa) | 244 ± 45 aa |
| Standard deviation of domain lengths | 45.12 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.23 |
| Pfam Score | 78.07 |
| Assigned Pfam label(s) | PF13196- PF03816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3FT28 | 55-299 | RQSQIWRAVGLLPLANSFTAWTGFRQRDIVVLGLDNGGNNTDTIFTVSVHNGETHITQIPRDSYLNSYSFGPLKVNALYARGGPEVV… |
| A0A0Q9LXC5 | 97-322 | RVLAIGSDARPGQPVEKCRGDALHIIGVDHKGVGGIVGIPRDSWVPLSSGGNAKVNAALVFGGAKGQVRTIEKASGVQIDGYVITGF… |
| A0A285CL90 | 43-264 | None |
| R7CM25 | 3-141 | None |
| A0A101P2L9 | 41-322 | None |
| A0A1F8P3K7 | 58-280 | None |
| A0A3E0GEL1 | 238-442 | None |
| A0A7Y3B4V9 | 210-415 | None |
| A0A516X127 | 188-518 | None |
| A0A396QK82 | 2-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.