DPCstruct | MC32847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R2SPW6 | 2-59 | AYKVIRTFADAEDDGRVYKKGQEYPHKDLKPKPTADRIKQLASADNNSGAACIEKIQT |
| R7ID13 | 1-52 | MYIVIKKFRDLKDSNHIYNENDFYPYCLKEIDEERALELKSDTNNFKEPVIR |
| A0A7U1BUL1 | 2-57 | None |
| A0A315Y323 | 1-61 | None |
| A0A6L9H1M5 | 1-61 | None |
| A0A0K9N8F6 | 1-52 | None |
| A0A285P040 | 43-102 | None |
| A0A1I4ZMS0 | 27-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.