DPCstruct | MC32840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 7.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0619 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A2RF74 | 3-132 | SLAPPEPSVTPDGLQSLVLTGKDVDGLTRTPGMYVNKTWTQTHELQHDDSFDPPECTDAVFNGLTASHRGSGYRAIYGVDLGRHTNG… |
| X8C375 | 46-172 | APPITEVGLKGLLLSADQVNAVMGASEMKVTRYRTQMSDDSATMEPKECLAVDGSAQEKVYAKSGYTAERDETLQEGDNFTHFVEQA… |
| A0A7G1I2Y8 | 1-112 | None |
| A0A081HYB2 | 29-156 | None |
| A0A7K1JYH3 | 15-154 | None |
| A0A1A2MIK1 | 63-195 | None |
| X8AFV5 | 131-253 | None |
| A0A1Y5PTZ8 | 25-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.