DPCstruct | MC3284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Standard deviation of domain lengths | 18.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 64.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2RPP7 | 2-97 | ALITTPPPSLSPPPSLSPPPPSGPSCPDLSVCLNILDGSPADDCCALIADLVDLEASVCLCIQLRVLGIVNLDLNLQLILNACGPSY… |
| A0A2J6LE91 | 15-138 | PSFTSDSNPSSSPNSNPTPNLSNANPNQNPSTNLNPPWATCPRDTLKLGVCANLLRGLISVEVGSPPVKPCCSLIQGLIDLEAALCL… |
| A0A6I9RXX4 | 20-154 | None |
| A0A2K2D5S8 | 4-122 | None |
| A0A1U8KHK7 | 1-116 | None |
| A0A835J3K5 | 101-246 | None |
| A0A0E0M6S3 | 472-576 | None |
| T1M9R8 | 1-101 | None |
| A0A1E5V9P4 | 22-127 | None |
| A0A0E0K7J4 | 4-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.