DPCstruct | MC32839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 161 ± 39 aa |
| Standard deviation of domain lengths | 39.12 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6Q1I7 | 5-122 | SELTRKDLELQFEEMPDFDTTCDVESYNMVIGQKRAVESIELGLNMDSKQYNIFISGKTGTGKTGYIVRKIEEYAKKMPTPQDWCYV… |
| A0A1Q7PYJ3 | 12-161 | LLPEQLRWACDPKTFPFKTTAELKADEVIVGQDRAVRALELALTIQQPGYNVYISGPVGTGRTTYARKKVQAVAAAKHAPPDWCYVY… |
| A0A0R3JSV5 | 9-178 | None |
| A0A2W1B4Q1 | 3-180 | None |
| T0E6H2 | 2-127 | None |
| A0A7U4P985 | 9-146 | None |
| A0A2D6NWY6 | 1-118 | None |
| A0A7R9N829 | 6-156 | None |
| W4LLM8 | 10-189 | None |
| W4LHK7 | 4-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.