DPCstruct | MC32837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 12.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8E2T2 | 1-109 | MRIFESPVFAFGAADDEYFIKYKDPEVIGEHYLMPREWLPGANTIVSYFLPFSQEIRKANSIDPYWPSEEWLDGFAEGQAFLNKLGV… |
| C6PUP2 | 1-118 | MKEKITAKIRDFVMDYQQKIDISTKWGEPLVGFADAKHPYILKLKELITATHGLPTEVLPDASIVIAYFVPFTEELANTNKVTGDIS… |
| A0A7V2KP66 | 12-160 | None |
| X1CZS9 | 1-130 | None |
| A0A5M9NXR8 | 268-409 | None |
| B9M0N6 | 184-319 | None |
| A0A1H7C3P4 | 158-273 | None |
| A0A2T0BD02 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.