DPCstruct | MC32832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 123 ± 17 aa |
| Standard deviation of domain lengths | 17.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6PPA4 | 6-123 | KYADYIKDLLNKASDYDAERKIFGSRNHQYKLNPIISEEQVKNFEKEHQIILPEEYRFFLTKIGNGGAGPDYGIFPLEDIMENEKYC… |
| V2YCS5 | 7-104 | LKELRQLLEKARTVDADLKQFGAKNHKYQWNPPAALSDVEEFEREFGVALPEGYRDFLLQAGDGGAGPFYGLFSLKQVRGWLGWPLE… |
| A0A3R6SM06 | 130-260 | None |
| A0A1G6I6I3 | 5-129 | None |
| A0A1P8WH06 | 8-159 | None |
| A0A6N7WMK0 | 55-193 | None |
| A0A2D0KPN4 | 38-129 | None |
| A0A4P2PYZ6 | 235-352 | None |
| A0A7W1IJM0 | 209-339 | None |
| A0A7X8MQ41 | 14-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.