DPCstruct | MC3283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 81 ± 3 aa |
| Standard deviation of domain lengths | 3.15 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 73.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YQ42 | 58-138 | MPFIKRHDRTFRLTDPSSEHCPPGEFVREIPLSTRIPEDANIEAYYDGPGSVLEIMVPKLRVGPEEHEVRVCLRPHLGGND |
| A0A5A7QEZ0 | 327-407 | TPFIKRHNRTFKLTDRSSEHCPPGEFVREISLSTRIPEDAKIEAYYDGAGTVLEILVPKLGEGPEEHEVRVCLRPHHNEVR |
| A0A1J6IVJ9 | 1-79 | None |
| A0A287K5H6 | 596-681 | None |
| A0A835U712 | 322-407 | None |
| A0A426YH17 | 371-446 | None |
| K7LZG8 | 420-499 | None |
| A0A4D9A296 | 378-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.