DPCstruct | MC32826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0IMU7 | 1-114 | MLKHMVGRITTKPGGKPEMGEAFVVDQYNRPLPRVRTSRPEPGEGGHRQLPPGTISVAHVHEIIQLYQGKSSNHPGPMSVDKIASKF… |
| A0A6A1VPZ5 | 11-104 | AFVVERYNKPMPKLRNTKPDSGRYEERPVLPGSLDVAQLRHIILLHQGKADDHEGPMNVEQIAEKFRVDVEQVQRILQFVSLPPEDS… |
| A0A6J1KJ83 | 25-140 | None |
| A0A4S4EKQ9 | 122-195 | None |
| A0A803MX95 | 81-190 | None |
| A0A438F6N0 | 1-84 | None |
| A0A5N6LK37 | 220-329 | None |
| A0A833QZ45 | 81-191 | None |
| A0A427AZ02 | 141-251 | None |
| K7TNL9 | 142-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.