DPCstruct | MC32825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5B0Z2 | 210-274 | IKAALPSRSDIPACLAVGRILAERAREADVYTASYTPRDRDKFEGKIRAVVQSLIDNGIDIKVYL |
| A0A835HZ43 | 238-302 | IKAVLKSRSDIPACLSVGQILADRAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDVKVYL |
| A0A4D6LJ64 | 126-195 | None |
| A0A484K3K4 | 323-389 | None |
| A0A7J7P976 | 229-293 | None |
| A0A287IDD2 | 98-172 | None |
| A0A7C9DDP0 | 85-145 | None |
| A0A287QFH1 | 1-83 | None |
| A0A068TS25 | 303-373 | None |
| A0A6P4NPT9 | 362-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.