DPCstruct | MC3282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 121 ± 4 aa |
| Standard deviation of domain lengths | 4.04 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1GUH0 | 85-206 | LKHWASCKVQQKDLSDEAIARAVCVKVGDSPGVSYSDIAAKAYECGRTELAIKLLDFEARSGEQVPLLLKMKRSQLALSKAVESGDT… |
| A0A315WD99 | 721-842 | LKHWASCKVQQKDLTDEAIARAVCAKVGDSPGVSYSDIAAKAYECGRPELAIKLLDFEARSGEQVPLLLKMKRSQLALSKAVESGDT… |
| A0A0B1T3A3 | 790-914 | None |
| A0A834DN63 | 224-345 | None |
| A0A1S8VEQ0 | 156-275 | None |
| A0A7J0G418 | 365-485 | None |
| A0A1U7WIX0 | 2-120 | None |
| A0A1B5L6Z6 | 175-296 | None |
| A0A6J1VWU1 | 216-337 | None |
| A0A6H0XIY7 | 445-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.