DPCstruct | MC3281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 244 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5JQC7 | 103-339 | FVRALGNPAVTEIIGMSKMLPIDQAKALQTKYPAFEAGVIPEGVYQGSPPIPSQDIPTIAVQRTLLTDKDTDMQTVQIITSVLNERR… |
| A0A2G8MK63 | 32-288 | VIAAPSAKSTARVVQAVEAASPGHGATIVAIPDGEAIVQRLPELQAVTIAAGTFGGRPKRPDDEVKTVGASYRLMARASLSRDTAAS… |
| A0A846A971 | 1-234 | None |
| A0A8A9E797 | 192-443 | None |
| A0A845YDV3 | 83-311 | None |
| A0A1X7MAR2 | 1-245 | None |
| A0A562R450 | 145-405 | None |
| A0A562ZKR8 | 325-563 | None |
| A0A661G0V1 | 199-408 | None |
| A0A4Q0SHK8 | 195-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.