DPCstruct | MC32805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 93 ± 16 aa |
| Standard deviation of domain lengths | 15.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816IEA3 | 4-66 | ATQIPPPYVRCIIEKTAKFVCKHGLEIENRIIASNVKNARFKFLSSSDPYHAFYKRKLYEYQA |
| A0A6A0HC48 | 1-89 | MAPVEGPVAPNPSDEKKNVIGFIYPPPEVRNIVDKTASFVARNGVEFESRIRINEQNNPKFNFLNPGDPYHAYYQHKVQDCRAGKPL… |
| A0A553N9W3 | 55-134 | None |
| A0A1I8IEI0 | 309-410 | None |
| A0A1V8SN43 | 1-124 | None |
| A0A022RDQ3 | 1-67 | None |
| A0A803QNX0 | 229-314 | None |
| A0A388LHK6 | 43-128 | None |
| A0A1E5UK60 | 81-154 | None |
| A0A2R6WW34 | 97-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.