DPCstruct | MC32804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 11 aa |
| Standard deviation of domain lengths | 10.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A044QPS7 | 544-715 | SVYNGTSQTELVLWQLIAPFSVLLRNIAVPWIFVGFRFVSSNGFWLKFVLDFLFIVLPVTLSLTLLSDHLSVILLFQLVALLSLITF… |
| A0A182EH53 | 3-171 | NGTTQAEILFLQFVGPMSLLLRNIAVPRIFHIFSCIFQINNWLIFIFDLLFIMMPVLLILTLLSDYIPLLLLVEAIIILIFVIVLIC… |
| S4RIL7 | 15-188 | None |
| A0A7R9KV93 | 15-176 | None |
| A0A6I8W6K4 | 36-199 | None |
| A0A2J8ABK6 | 7-163 | None |
| A0A368F576 | 170-357 | None |
| A0A2P4WF89 | 106-287 | None |
| L0PCG6 | 27-219 | None |
| A0A673JW42 | 13-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.