DPCstruct | MC32800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 3.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 64.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182E9T6 | 8-63 | TNVMNSTSTNFSDNYEVKEELGKGAFSVVRRCVQKRTGLEFAAKIINTKKLSTRGL |
| A0A4Z2CHE8 | 17-65 | LCDIQTPISTEPMESVYELTGELGRGKFAVVKRCVDKATGKVFAAKFIR |
| A0A1J1IPH7 | 1-54 | None |
| A0A2K5M5I4 | 1-53 | None |
| A0A0M3I0B1 | 7-61 | None |
| A0A7N4NI32 | 178-228 | None |
| A0A670Z6P3 | 1-51 | None |
| A0A485NCF9 | 1-56 | None |
| A0A0V0Y757 | 42-95 | None |
| A0A3B5MBK5 | 9-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.