DPCstruct | MC32798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 181 ± 29 aa |
| Standard deviation of domain lengths | 29.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.94 |
| Pfam Score | 91.50 |
| Assigned Pfam label(s) | PF16837- CL0361- PF13297- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803LVD0 | 214-396 | EAKVNKLCELLKDVLERTRERVRNRQGMTFDELVRDRDADHEILVHDIGSDNADEKRDCNPLKLPLGWDGKPIPYWLYKLYGLNQEF… |
| A0A182E4Z1 | 6-182 | KSIYSRLSSLLSDEREATKENVERKQARGIGENMEEEEDINDMSDDDDDDSIPYNPKNLPLGWDGKPIPYWLYKLHGLNISFPCEIC… |
| A0A200R0P5 | 185-307 | None |
| A0A1J3GX89 | 66-223 | None |
| L1LE89 | 920-1082 | None |
| K0TRI9 | 364-558 | None |
| A0A7J7ILG8 | 3-183 | None |
| A0A7S3PQD2 | 53-239 | None |
| A2DYJ8 | 331-501 | None |
| A0A1X1BK82 | 943-1127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.