DPCstruct | MC32797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 338 |
|---|---|
| Mean domain length (aa) | 163 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.63 |
| Pfam Score | 74.05 |
| Assigned Pfam label(s) | CL0622- PF16543- CL0329- CL0229- CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182E0D4 | 2-151 | AEEEVEVLRSIYGDELVVEKDFADNTSPIVLSMKMRPTLLKSQCTASIQTIIELPVQYPKISPKVYLRQQRGIDESNVNILQKNIEQ… |
| E1ZP52 | 365-495 | GEMDSLQAQLEEIEALQACYPDGLIAFSAAEADTLRFAAAVAEGTSGAASADDVPALSGTLWLPGLELAGAPVQLKFVLPKCSSGEA… |
| A0A7R8X6H0 | 193-339 | None |
| A0A7R8X5U2 | 183-320 | None |
| A0A0G4H487 | 14-181 | None |
| A0A0C9S067 | 82-226 | None |
| A0A3Q4HYS4 | 8-148 | None |
| A0A7S2SNU7 | 7-199 | None |
| A0A158R655 | 14-160 | None |
| A0A7S2RRP9 | 57-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.