DPCstruct | MC32796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF14666- CL0542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7JJL1 | 69-220 | LFQCLLNLCSVKNQDAVLKLAVTTLDYSRDGLARVILSKVLTASTDICRLYATKHLRVLLRAGVEFFSSWGMELLVTQLHDHNKVVS… |
| A0A182DZJ9 | 1-152 | MSNDLFVDLVKNTRNVEYIKLIVSCLDYSSKDSFNRFILQTALTSATEAGRKWTTQFLSILASHNISDFSVWVIKLLLGQLADSSAK… |
| A0A6V7W6T9 | 1-179 | None |
| A0A0N5AJA8 | 22-180 | None |
| A0A183TVS9 | 31-182 | None |
| A0A0R3S5L2 | 35-186 | None |
| A0A0K0DCR0 | 9-135 | None |
| A0A0N4UN80 | 13-165 | None |
| A0A7E4VAR3 | 113-262 | None |
| A0A1I7SJA7 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.