DPCstruct | MC32795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 210 ± 29 aa |
| Standard deviation of domain lengths | 29.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | CL0020- PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8VSN3 | 8-250 | TIGDGLITQNPALLIALTAGIIVTRVTTDNPTEDSASADLASDISGQIGAQPRALLVASGLMLVFGLIPGFPTPVFVLLSIVTGGGG… |
| A0A7C3AXM0 | 409-606 | ITLCREVPTYHANLSGAWEQVKEPSKHDAIAKAIESMDNAHELAPDNKKYLDTLERLYAQKAELDLYGQCEMVKFYTCVTPVAVEYA… |
| A0A381H8J3 | 133-340 | None |
| A0A489FML9 | 179-371 | None |
| A0A6L5C5S0 | 188-407 | None |
| A0A6G6WPP6 | 561-711 | None |
| A0A447U461 | 20-213 | None |
| A0A381GS07 | 90-287 | None |
| T0DUK7 | 65-277 | None |
| A0A376RNJ2 | 2-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.