DPCstruct | MC32794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 199 |
|---|---|
| Mean domain length (aa) | 132 ± 28 aa |
| Standard deviation of domain lengths | 28.41 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8VPR9 | 10-137 | TEEIISVAELKERLKSNKPLIVKAGFDPTAPDLHLGHTVLINKLRYFQQHGHIVKFLIGDFTALIGDPSGRNVTRKPMSMEEIKENA… |
| A0A7J8K3Z9 | 146-285 | QVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGYAVENAKDIIACGFDINK… |
| A0A4Y7L5E5 | 118-264 | None |
| W9X552 | 3-116 | None |
| A0A0V0QA80 | 216-360 | None |
| A0A194VM69 | 530-647 | None |
| H2G178 | 9-154 | None |
| A0A535YRP2 | 60-201 | None |
| A0A165YZ03 | 324-479 | None |
| A0A4T0HE67 | 675-792 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.