DPCstruct | MC32793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 113 ± 18 aa |
| Standard deviation of domain lengths | 18.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03717 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8TJD0 | 5-127 | FPLKDIQQEKRIYRGRIFFAVGLVIICLLVLASRYAYLQIFHYDEFSTASDKNRIRLQPLPPARGYIYDRNGVLLADNYPVFTATLS… |
| A0A6N8UJ60 | 11-109 | SNEQKKTMLVRTIVVGAISMVLIAGILLRLFQLQILNHERYATRATDNRLVTQPLAPARGLIFDRNGNVLAGNKQVQSLSVVGENVE… |
| A0A534PVV8 | 1-119 | None |
| A0A535EUA5 | 5-145 | None |
| C3DK13 | 1-132 | None |
| A0A7Z9T096 | 1-117 | None |
| A0A828T677 | 6-117 | None |
| A0A485B2R2 | 1-149 | None |
| A0A2X1PR32 | 3-102 | None |
| A0A0B7MFG6 | 3-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.