DPCstruct | MC3279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 152 ± 25 aa |
| Standard deviation of domain lengths | 24.93 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523BZ71 | 54-249 | VWHIWDGRKDGFNALVNYHRLAGPDGEGRRALEALTYTYLGDWIERQKAEQREGKEGADARLAAALDLQEQLQKILEGEPPYDIFVR… |
| A0A101G880 | 1-161 | METLTYSYLGDWINRQKDGVKRNEDGAEDRLAAAVELQKRLIAILEGDPPFDIFVRWKPVEKQPVGWNPDINDGVRINIRPFMASDI… |
| A0A3A4N9W9 | 127-281 | None |
| A0A235EXA7 | 190-330 | None |
| A0A1G3ABQ6 | 310-461 | None |
| A0A3D5SU07 | 686-879 | None |
| A0A1J5DXB3 | 1-190 | None |
| A0A7W0WI44 | 1-120 | None |
| A0A7Z0I295 | 253-382 | None |
| S9PJM5 | 153-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.