DPCstruct | MC32788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8LBT3 | 1-81 | MVLQTSERVLFTNRAQLTKLRTPHVLSLPALYLKHNWPLRYVGVNSSGNRIAVAGSHGIAHYNYLTQRWHVFGNEIQVSLS |
| A0A2S4USQ6 | 182-264 | KHAFLQLDDRVSVYRGADCPDLSVINPKSDVWQHIKIPADYISTNWPINYSCISEDGKLLAVAGTRGFTHFNSVSGRWKLFEN |
| A0A820SQ46 | 1-99 | None |
| A0A3R6WSI1 | 98-177 | None |
| A0A183H7Y5 | 38-119 | None |
| A0A6D2IDE4 | 323-397 | None |
| A0A1D6HMK3 | 156-230 | None |
| A0A0L0HCF7 | 281-364 | None |
| A0A819JCN4 | 425-518 | None |
| A0A2G5V263 | 262-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.