DPCstruct | MC32786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 179 ± 21 aa |
| Standard deviation of domain lengths | 21.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443S727 | 2-163 | KIYMQLLAQAKKVDKAGENRNYFAARMTNEINEIIRVLQLTTYDEGEWDADNLTCIKKAQNAINGNLQTAHDWIEDPMAVTGGIGEK… |
| A0A3P8L501 | 1-179 | MISELFYTRSAKLRLRFLSCTLLYTDLPGAAECQANRDFLVSEMCDEIQEIIRGLQLTETDASELFDDDLAAIHVTKATLDSRLHFA… |
| A0A0C2FQV5 | 2-149 | None |
| A0A0L8FX90 | 42-214 | None |
| A0A5K3FA47 | 1-203 | None |
| A0A6I9WM51 | 237-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.