DPCstruct | MC32781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 91 ± 16 aa |
| Standard deviation of domain lengths | 16.22 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 68.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q98UF7 | 943-1028 | NTRLASQLDRNPGSDDNNLNSIFYEHLTRSLQHSLCGDLLLGRWGNFSTGDCFILASDYLNALVHLIEIGNGLVTFQLRGLEFRGT |
| A0A1L8G8K0 | 362-431 | DDNNLNSIFYEHLTRSLQKSLCGDLVLGRWGNYSSGDCFILTSDYLNALVHLIEIGNGFVTFQLRGLEFR |
| A0A6J1W687 | 3-113 | None |
| A0A183W021 | 23-126 | None |
| A0A5B7EEI3 | 2-72 | None |
| A0A3M0KP09 | 10-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.