DPCstruct | MC3278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 161 ± 18 aa |
| Standard deviation of domain lengths | 17.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101G6Z6 | 4-184 | ENARKNNVELKLDKSKLGLPEFQKLWANINAKSVYVVEFDQDELIQKAISALNRDLRVSKIFIKVETGTMTDIQSREQLQRGAAFVK… |
| A0A4V1UIN3 | 203-358 | KRKVLSAEDEALFKAIWQKINYQTRYTVKLDTPKLIEKCVAALTDFNQYPKVQAPKIRAHKAKLIINQQGVQGVETGVDRSIAQVQD… |
| A0A1H2CWS8 | 495-627 | None |
| A0A3A9HGV7 | 513-692 | None |
| A0A2G6EZW5 | 204-346 | None |
| A0A855HRZ5 | 425-601 | None |
| A0A640XJ32 | 6-146 | None |
| A0A378NDZ2 | 10-172 | None |
| A0A327Y5D2 | 10-146 | None |
| A0A0R1MH10 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.