DPCstruct | MC32777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 289 ± 61 aa |
| Standard deviation of domain lengths | 60.85 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183BAF7 | 36-271 | AYSFIDQILTHFISVNFLGGNCDNLEYDQCLDEQALSALSCEGERPFKYAKALGLFWLSKRLASRMSEVSRTMVIRFGHVNKLSAIQ… |
| A0A4Z2C676 | 26-351 | SGTGEVGSLLESLMEGDFEAVLRNQHILDLLAGDGSGADEDIEAYLEGRVSLYLTCGPCDDQRTRELVLLVLAASCLHLFAQSNWTG… |
| A0A3P7IFV4 | 30-208 | None |
| A0A6A5DSE8 | 11-282 | None |
| A0A1I8HWB6 | 253-508 | None |
| A0A813M770 | 1-196 | None |
| A0A178UFY4 | 43-401 | None |
| A0A540M4Y9 | 51-449 | None |
| A0A4Z0A5Z9 | 43-350 | None |
| A0A512ULQ3 | 2-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.