DPCstruct | MC32775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11251 |
|---|---|
| Mean domain length (aa) | 235 ± 44 aa |
| Standard deviation of domain lengths | 43.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.34 |
| Mean intra-cluster sequence similarity (%) | 11.32 |
| Pfam Score | 82.09 |
| Assigned Pfam label(s) | CL0213- PF01933- CL0536- CL0113- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8VUS8 | 54-332 | AKGTILSLVRNSDLEDIISSIQQLEEEYNKNFGYPYTFLNDEEFTDEFKDGIKSILPKDRVVEFGTIDPDNWNMPDSIDRERYDQEM… |
| A0A183BA59 | 3-240 | DLLILIKSAITHRSRRMIIRNLWANNQCWGNLIVRHVFVLGTVKSISDVWLKLIDKESQQFGDLIQGNFIDNYYNNTHKMIFSIRWA… |
| A0A7R9L1X3 | 5-242 | None |
| A0A7R9L4F6 | 63-449 | None |
| A0A7R9L4V1 | 335-553 | None |
| A0A1G6PZB5 | 81-348 | None |
| A0A6J7SLK0 | 2-196 | None |
| A0A7C1B688 | 90-342 | None |
| A0A7J0G1Y3 | 257-485 | None |
| A0A1Y1NBC9 | 2-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.