DPCstruct | MC32774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 190 ± 20 aa |
| Standard deviation of domain lengths | 20.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 33.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183B6K4 | 1-203 | MLDTSLLEIVQHQRDRFRARAEELEQAEASVRQHLTSVQRELESVRADNVKLYEKIRFLQSYSSPIGARSESFAAGSGSGLSGNNRV… |
| A0A820HLU0 | 258-424 | DEALTAIVISQRERFRIRNVELENENVSLKQQINIFQKKMDKLRSDNIKLYEKIKFVQTYLSTRGTDDSIDRYSRGYDASLDPFTNF… |
| F0ZWT2 | 1-211 | None |
| F4RJF1 | 514-690 | None |
| A0A0G4NG94 | 272-453 | None |
| A0A0D6R1V9 | 89-258 | None |
| D3BQF7 | 318-546 | None |
| A0A7S1DN47 | 130-312 | None |
| A0A0C2C771 | 29-196 | None |
| A0A430Q9M8 | 321-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.