DPCstruct | MC32773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 14 aa |
| Standard deviation of domain lengths | 13.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444SEL8 | 3-103 | FKTWEELTQFTNSLDRARRFDIDLLNKLGVTTVMDLMVEYKKLKWGVIVSSSEKIDKEKRYEEFNLISVPYPGAEFFAEFTQNNMNS… |
| A0A183B3A5 | 1-122 | MFSGFGFDTSLDLPVNSSLPPEQNDSNENDRSTFSRLRDADRALLKRFHVHYICDFMVEFKKMKYWVPVTSSEKADPHNRYHDFEII… |
| A0A218VD86 | 30-171 | None |
| A0A182YDI3 | 207-339 | None |
| A0A6J0C9U2 | 159-265 | None |
| A0A5K4EHM3 | 133-249 | None |
| A0A094ZMU7 | 8-100 | None |
| A0A4W3JIZ1 | 115-244 | None |
| A0A1B0GQJ8 | 102-229 | None |
| A0A0T6B3W5 | 146-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.