DPCstruct | MC3276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850SAY1 | 2-91 | LTLHEDAFYEFFRPYRHPQSSCDIWGGIGLETFGEDLKLVKSLPAAHLWTVVDGDGDQWILPGIHCVNRICYLVTEVAHDWRDLEFR… |
| A0A1V4R5M9 | 5-99 | IDTISFDEFKDIFEPIDNFMDQDASMDGKLFDFYGDELKYIKDEANSGTVWTVIEDIDSRYILEGFHIKNRAGYLISTIPNSNINIS… |
| A0A2E8JPW4 | 1-101 | None |
| A0A218PUN1 | 77-166 | None |
| A0A3N8E2S6 | 4-76 | None |
| A0A0U3PJI3 | 71-163 | None |
| A0A246JWX1 | 11-111 | None |
| A0A367UHW8 | 262-359 | None |
| A0A433CI05 | 6-96 | None |
| A0A5D0HWL3 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.