DPCstruct | MC32759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1748 |
|---|---|
| Mean domain length (aa) | 190 ± 38 aa |
| Standard deviation of domain lengths | 37.68 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.38 |
| Mean intra-cluster sequence similarity (%) | 10.26 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0193- CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I5BSI1 | 20-218 | DRSIHPDTELNHYFTGDIALGRDFEIRDSLTLNLHGGFKYTDVKWTTFGGSFVYSENGFRDDIGNFRDSERGISYQQKFPGVFLGAE… |
| A0A7C4IMB3 | 12-201 | VLVFASTSFAAEKYALGMGNIALKVDYINFTEDAFEDIEIENGVYVGLEGFYSIYPNLYLGLEAGWAGPSNDSDIEIDGEEFNVDVD… |
| A0A1F3VUP7 | 3-275 | None |
| A0A496SRT3 | 135-339 | None |
| A0A7Y3CJU6 | 720-905 | None |
| D3UGY2 | 706-899 | None |
| A0A6L3ZCQ8 | 239-490 | None |
| A0A1G3KJR1 | 10-219 | None |
| A0A454CZG8 | 3-151 | None |
| A0A3C1KXH7 | 253-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.