DPCstruct | MC32758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0CN76 | 2-75 | QSYQLKIKLNKKIKLQIGKLGEFLLKKGIYIYTGSAKKNIDSRIKRHLCNKKKLHWHIDYLLLNKNVKVIDVNK |
| A0A7C3QDD0 | 30-90 | ATGLYHLILHLKRPERLRVGRLGLQEFPAGYYLYTGSARRGLASRLQRHLCKEKTSHWHID |
| A0A5N9G5W4 | 32-107 | None |
| A0A3D4HL67 | 164-232 | None |
| A0A7V2EGW6 | 2-58 | None |
| A0A2T2UL25 | 20-95 | None |
| A0A7X6DT19 | 11-89 | None |
| A0A0M2V061 | 90-166 | None |
| A0A517XW54 | 278-357 | None |
| A0A2D5YJE8 | 30-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.