DPCstruct | MC32755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 134 ± 22 aa |
| Standard deviation of domain lengths | 22.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09828 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1TRF2 | 12-124 | IFVPKSRVIETAEKEGAIPFDSPGAELDHQGDLCTFDVIIKEYGLTDKALLRMARIINAADTGRLDDDPAAAGLEAVATGYSIRFPD… |
| A0A7J3T1T6 | 2-139 | KWVTRLNVHVDRTACPWLIKRFVDPKAEFLFVPVEKIEETVQKEKAIPYDAPGVELGHHGDKCSFDAVVEKYKIKDPAVLELAKIVR… |
| A0A849EGX2 | 69-211 | None |
| A0A4U1I5R0 | 1-90 | None |
| A0A0E1W8P9 | 62-198 | None |
| A0A1V5XUL0 | 197-365 | None |
| A0A0K9I1Z5 | 76-224 | None |
| A0A843T585 | 168-304 | None |
| A0A534P354 | 13-169 | None |
| A0A7H4MLP3 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.