DPCstruct | MC32750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 75 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06189 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7I6E7 | 124-199 | RTYLVTARSAASSGARALKTLRLWGLEIDEALFLAGAPKGPILEKIRPHIFFDDQMFHVEGAAEMGTVACHVPYGI |
| A0A3S9VG06 | 19-83 | GERVVLTFREWGTPFDEAHFVGHHAKAPFVEAFDAHIFFDDQEKHVLGARALVPAGHVPGPHAAD |
| A0A0S2LWH4 | 35-107 | None |
| A0A259Q381 | 566-642 | None |
| A0A5N9VUP3 | 149-224 | None |
| A0A3M3A2W2 | 67-135 | None |
| A0A1V6F6K7 | 94-167 | None |
| A0A7C1M167 | 80-153 | None |
| A0A3T0Y3P4 | 11-73 | None |
| A0A2D4IXP7 | 25-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.