DPCstruct | MC3275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 173 ± 12 aa |
| Standard deviation of domain lengths | 11.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1VPX6 | 1-180 | MLYGQAEATSPPDGVLLPSALINNLANAQPSAEGREQFYMKLDPRIHWSHNRSEQWYNLKMEEIKARGGRKANFGKAAQRMRQQRLE… |
| C7YRM1 | 242-394 | PPPGVVIPSRKTRKAKASSEEPRLFLPVNPAIHRMHNRSEDWYKKKCQEIKHRPRRKAWFGKVLERQRWLNAREAKLDEECEQARLA… |
| A0A014MXB4 | 387-565 | None |
| A0A1B7Y6E9 | 125-303 | None |
| G2WRV4 | 1-187 | None |
| A0A2K0WEQ1 | 198-353 | None |
| A0A395RZR5 | 59-228 | None |
| A0A2J8DL72 | 72-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.