DPCstruct | MC32746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 418 ± 71 aa |
| Standard deviation of domain lengths | 71.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A172TX08 | 10-415 | LKVIQSGDVEELYIHITKKALEWAICGFTEEANQLLGVLWGYNFKHSEQLRSVEQGLQVFWQASRTTPANVPFPFIDIDEIEKENWN… |
| A0A2J6PWN5 | 7-477 | PTQILRTIGEQELGYTLYDFAAEFAVLGYLEITRELVGLVNKYAPLYRETAQDLFKPLWLIWDMTGIWPGGEQAHVQRSANSRNEES… |
| A0A6A6ZAQ2 | 3-367 | None |
| A0A4V1XFT2 | 11-559 | None |
| Q0U1F7 | 21-544 | None |
| A0A1M3MTN5 | 1-355 | None |
| A0A4Y9YC90 | 380-799 | None |
| A0A6C0GL25 | 2-299 | None |
| A0A2V1CUL3 | 33-508 | None |
| A0A420MFW1 | 3-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.