DPCstruct | MC32744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 11.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A219ANV2 | 66-163 | KGVNEMRSDVQDTKNVVKGLELEQKREKTERWLSPPDPSTNYNNAMRQRQEGSGLWFLQTDAFVEWKQRRNSFLWLHGIPGCGKTIL… |
| A0A2J6PH73 | 3-91 | QTIETGVIISGISNAQIKATKSEIIKWLAPVDPRANQEAARKKHEEQTGRWFTEGENFSNWLEQPNSLLWLHGIPGSGKTILCSEII… |
| W9X5C6 | 124-206 | None |
| A0A4Y8CP23 | 5-98 | None |
| W4KL79 | 201-306 | None |
| A0A4U0Y4S6 | 157-261 | None |
| A0A2J6RBD5 | 643-752 | None |
| A0A2N3MZT0 | 26-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.