DPCstruct | MC32740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 476 |
|---|---|
| Mean domain length (aa) | 257 ± 60 aa |
| Standard deviation of domain lengths | 60.02 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.31 |
| Pfam Score | 84.78 |
| Assigned Pfam label(s) | PF00557- CL0356- CL0260- CL0458- CL0544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177WSI2 | 11-248 | ILKPDEIEKMRIVCKLGREILEEGKKAVKVGVTTDEIDRVIHEACMERDVYPSPLNYYNFPKSVCTSVNEVICHGIPDKYELQDGDI… |
| A0A7X5WC67 | 83-361 | GGGRAARQRSGRGPAELADPGLILDDMRLVKEPAEIDAIRDAVRITIAAFRDALPLVRPGTGEWQVEAAVEAAFRDAGADGPAFATI… |
| A0A4Z1IW17 | 125-277 | None |
| A0A7R9PTB6 | 105-277 | None |
| C3ZF22 | 683-945 | None |
| A0A1A9X9E0 | 412-645 | None |
| S9SLB6 | 84-342 | None |
| A0A2B4S140 | 18-261 | None |
| A0A0K0EBT1 | 26-273 | None |
| A0A1Q9T7N1 | 5-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.