DPCstruct | MC3274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 46.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654HEF7 | 267-359 | TTPFRKISGDFVSVKNVDGKRVLHVEGKGLTLLAQQAMVDVAHLLRPAHLQSLANILKDPEASSNDKFVALELLKNANIAAGMILPS… |
| A0A379TIB5 | 1-102 | MGEDKTEYYLLTSDYVSVGSFEGESILKVEPQALTLLAQQAFHDASFMLRPEHQQQVASILHDPEASENDKYVALQFLRNSDIAAKG… |
| A0A3P5DIQ0 | 15-128 | None |
| A0A1A8WNY6 | 115-201 | None |
| S9U4F5 | 18-135 | None |
| L1LEK8 | 83-217 | None |
| A0A388NRQ0 | 2-104 | None |
| A0A378C7M3 | 2-105 | None |
| A0A1I8JM47 | 2-132 | None |
| A0A0A2VU39 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.