DPCstruct | MC32738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 380 ± 33 aa |
| Standard deviation of domain lengths | 33.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3PGA1 | 2-316 | DGGFPERAGEALPRLDALVLSAVRELQARIVTFLETDDGALTAAAASLLAGAGRCGRIPTSPKDIDLLNALLWVPEPNHQRPDAAAR… |
| A0A7X4IZZ6 | 1-399 | MNTWADNQRDLDARATNNLKKLVHKSILQNLDASALPTNLGPDFDQRFNREKHLHIVGSVTDQRRGAPIVVVKRDVETAAALRGLIL… |
| A0A1C5RK07 | 2-332 | None |
| A0A402AVS9 | 296-722 | None |
| A0A0M6X0I8 | 1-383 | None |
| A0A6B1H6I2 | 511-895 | None |
| A0A1E4QTC1 | 195-590 | None |
| A0A1A2JFK1 | 261-658 | None |
| A0A7U9XN50 | 99-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.