DPCstruct | MC32737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 166 ± 17 aa |
| Standard deviation of domain lengths | 16.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0020- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447JK49 | 16-182 | VADAFRAVLLDEKIDPALAAEILTLPSANEIAELFEVIDPIAIAQVREALTRTLAAELADEFLAIYNANHLDEYRVDHGDIGKRTLR… |
| A0A095TFR0 | 62-225 | LVPVLEQVIGRADEDPAQAALLLSLPGEVALGDRHTPLDPGGIHAAHHAMKQALGKALQGHWLSLAENLIATELEMDGRAMGRRQLR… |
| A0A855HS95 | 19-188 | None |
| A0A2X1QHJ0 | 1-137 | None |
| A0A1R3IU30 | 304-454 | None |
| D8RAE8 | 545-707 | None |
| A0A7S1KEH5 | 100-295 | None |
| A0A5R4S6Z0 | 1-135 | None |
| U6LDM1 | 177-332 | None |
| A0A812NHE2 | 871-1068 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.