DPCstruct | MC3273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5FW99 | 361-486 | YIVNKEDLSTVCDNLYRVGIEGRSFHENSDIYNVFIREFYWSSIYSQAVVDEYYKKVPFSVGHKNFDNITIEPAYLQYALSSVADAS… |
| A0A379THB8 | 1-148 | MAMQKKHLWYHIRSYLLKEDELPTLISNLNKDLPLIRNLPESHDQYRVFSREYYWSPAYQYFDDPYYGDKGWQNIYTDWQKQGEPIA… |
| A0A3G6YIN5 | 1-169 | None |
| A0A808JJT4 | 238-347 | None |
| A0A378N6F1 | 513-646 | None |
| A0A0H3K8X2 | 3-112 | None |
| A0A5C9ENH6 | 79-223 | None |
| A0A6P3C6C3 | 49-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.