DPCstruct | MC32726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 173 ± 32 aa |
| Standard deviation of domain lengths | 31.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A411PN09 | 60-240 | TEDGPYYDSSDATIAFPYWFYTEVKQRFTKANYGQTGVSVADASLDAMVHTTFHELAHAVIDIHQLPVVGKEEDAADGLASVLMIEF… |
| A0A836U1S8 | 38-197 | DNFTLEVMGRFYDAKYVDTEEQLFGVTMDVIEHTLHHELGHALIHVLDITITGKEEDAVDGMATMLVILTNQTGSEIALSAADLFDL… |
| A0A100IZU6 | 55-241 | None |
| A0A537L955 | 102-270 | None |
| A0A855GC71 | 370-571 | None |
| A0A4Q2XZ02 | 82-233 | None |
| A0A7W0Q4N1 | 189-380 | None |
| A0A1Y5TLH4 | 17-182 | None |
| A0A075HRR2 | 68-274 | None |
| A0A5P9GWY2 | 365-511 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.