DPCstruct | MC32724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 158 ± 36 aa |
| Standard deviation of domain lengths | 36.48 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836SBI0 | 12-143 | LQKKHNQCAYCERKIEKTNSHIEHIRQRDKFHKLECEYSNLVLSCNDENSCGKYKDSHKNPIAKFWQDEFIHPVFDNPEAFFSFNED… |
| A0A800ACF2 | 2-112 | CEYCLSKSDLLGMDLEVEHVIPESLGGASSLDNLCASCPICNRHKSSRIWAIDPDTRRRVRLFHPRQQQWNRHFRWSEDGTLILGKT… |
| A0A2V5X3S5 | 8-163 | None |
| A0A1M7GUX5 | 11-132 | None |
| A0A6B1DBX4 | 32-147 | None |
| A0A523E0C1 | 2-123 | None |
| A0A5C5ZAA7 | 2-125 | None |
| A0A3C1S415 | 36-143 | None |
| A0A1W1BAR4 | 4-164 | None |
| A0A2V5WZ79 | 2-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.