DPCstruct | MC32723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 69 ± 3 aa |
| Standard deviation of domain lengths | 2.75 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7YQW8 | 1-66 | MKSFKEPVTHEEFSRIRAGFIAQGASFSGWCKLHQVTPSNAKAALVGSWNGPKAKELRTKIIAASG |
| A0A2A5G6A0 | 1-71 | MKGIKHTHTPGAELHRAVKAGFMFRGTTLASWCRTNKVFASNARQALLGSWAGPKARKLVNKLIADSQAEK |
| A0A2S5QV10 | 5-75 | None |
| A3YAH6 | 119-185 | None |
| A0A1Y2K7M1 | 1-71 | None |
| A0A495V5G3 | 1-70 | None |
| A0A1Z4C0G4 | 1-68 | None |
| Q7MJL0 | 39-111 | None |
| A0A176S613 | 27-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.