DPCstruct | MC3272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 6.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.31 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0754- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M9F6P9 | 3-88 | HERACQLAQPQDLIDIAEVVTAYYTRTPDADNPDQQVAFGTSGHRGSSLDTAFNESHILAITQAIVEYRAQHHIGGPIFIGRDTHA |
| A0A379TGU5 | 19-101 | QSTTVAGQPAQQSDLINVAQLTAQYYVLKPEAGNAEHAVKFGTSGHRGSAGRHSFNEPHILAVAQAIAEERAKKRHYRPLLCG |
| A0A1A9X722 | 3-90 | None |
| A0A7C2YPD4 | 5-91 | None |
| A0A1A9Z171 | 12-84 | None |
| A0A521G5K1 | 4-91 | None |
| A0A1F7LXZ7 | 1-87 | None |
| A0A534NBQ4 | 1-88 | None |
| A0A2S6IEF6 | 3-75 | None |
| A0A1V5JJQ0 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.